PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_01198.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 348aa    MW: 39710 Da    PI: 4.9163
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_01198.1_g00004.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1752.1e-5481362129
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              ppG+rFhPtdeelv++yLkkkv+   +++ +vik+vd+yk+ePwd+++   + ++ee+ewyfFs++dkky+tg+r+nrat sg+Wk
  Rsa1.0_01198.1_g00004.1   8 PPGYRFHPTDEELVDYYLKKKVAFPGMQV-DVIKDVDLYKIEPWDIQElcgRGTGEEREWYFFSHKDKKYPTGTRTNRATGSGFWK 92 
                              9****************************.99**************954555555788**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              atg+dk+++s k+elvg++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_01198.1_g00004.1  93 ATGRDKAIYS-KQELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.28E-596156IPR003441NAC domain
PROSITE profilePS5100558.5587156IPR003441NAC domain
PfamPF023654.4E-288135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009620Biological Processresponse to fungus
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0010981Biological Processregulation of cell wall macromolecule metabolic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0090058Biological Processmetaxylem development
GO:0005634Cellular Componentnucleus
GO:0009531Cellular Componentsecondary cell wall
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MESLSFIPPG YRFHPTDEEL VDYYLKKKVA FPGMQVDVIK DVDLYKIEPW DIQELCGRGT  60
GEEREWYFFS HKDKKYPTGT RTNRATGSGF WKATGRDKAI YSKQELVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GPPHEEGWVV CRAFKKKLTT MMNYSNPRTM MGSSSSGLDS  180
NWFVQQMDVA NGNYYHLPDL ESPRMFQASS SSSLQHNGND PYVAVLSTIN ATPTTLMQGD  240
DEVDHGQVIT NDDDHMIMMN TNTDHQHQSG LLLNGDHNDQ VMDWQTLDKF VASQLIMSQE  300
DEEVNKVPSD NSSNETFHLS EEQATMVSMN ASPSSPCSFY SWSQNTHA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-50715715169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00578DAPTransfer from AT5G62380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0265100.0BT026510.1 Arabidopsis thaliana At5g62380 mRNA, complete cds.
GenBankDQ0567340.0DQ056734.1 Arabidopsis thaliana no apical meristem family protein (At5g62380) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013626924.10.0PREDICTED: NAC domain-containing protein 101
SwissprotQ9LVA10.0NC101_ARATH; NAC domain-containing protein 101
TrEMBLA0A0D3BFT40.0A0A0D3BFT4_BRAOL; Uncharacterized protein
STRINGBra010077.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122481732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.10.0NAC-domain protein 101